PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000802924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 355aa    MW: 40249.7 Da    PI: 7.9667
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000802924genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.8e-50131401128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lp+GfrFhP+deel+v+yLk+kv++++l++ ++i+e+d+yk++Pw+Lp k++ +e+ewyfF++rd+ky++g+r+nra+  gyWkatg+dk+++s+ 
  MDP0000802924  13 LPAGFRFHPSDEELIVHYLKNKVTSSPLPA-TIITELDLYKYNPWELPPKASFGEEEWYFFTPRDRKYPNGSRPNRAAGLGYWKATGTDKHIFSSc 107
                    799***************************.89**************97778899***************************************98 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +++ +g+kk Lvfy+g+ pkg+kt+W+m+eyrl
  MDP0000802924 108 GTKSIGVKKALVFYTGHPPKGVKTEWIMNEYRL 140
                    8889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-605167IPR003441NAC domain
PROSITE profilePS5100557.83813167IPR003441NAC domain
PfamPF023651.1E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MERENQATEN IQLPAGFRFH PSDEELIVHY LKNKVTSSPL PATIITELDL YKYNPWELPP  60
KASFGEEEWY FFTPRDRKYP NGSRPNRAAG LGYWKATGTD KHIFSSCGTK SIGVKKALVF  120
YTGHPPKGVK TEWIMNEYRL LDTTMWTSKQ KGSMRLDDWV LCRVRQKCNN TRSIWEDQNS  180
PPSYKLGAYT KQVDGPCSND TNPSIEMVRN YLYKDCPMLP YIFASPELPY AKTASSISFQ  240
GTGNTKSCST SLHENNSNET NELLLVYSID DLINPLKRKP TEGNGYKSFV TPSKRICSRD  300
YKEEXVNSST SRDCRAMNLW GVDQSGSADN NLNADQGSSM IXYQELSQLI GFQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-6711693170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.220931e-174fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008355629.10.0PREDICTED: NAC transcription factor 29-like
TrEMBLM5WDR20.0M5WDR2_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g02110.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.17e-79NAC domain containing protein 25